4 florfarnichcovarkampas 2 bhk 1170 sqarfittulip 2 saalpuranimaltiliftcarparkinggardcctvckamralokasan 140 dimand 80 laknigosablhai 1 linkmaihai 7693924934 ridisidiproparti

golden investment offer land size 223 acre zone industrial na land location mulshi andhale gaon owner company own property in shares rr price 250 crores market valuation 1000 crores land ratio 70 % hill can be developed completely price 120 crores slightly negotiable ️ please note _this land is not suitable for schemes at present this is suitable for crusher plants first after developing this land investor can easily earn 500 to 1000 crores by just doing plotting project crusher plant business is extra this land can be used as a collateral and can get 500 crore loan in future after developing the land investor can cover his investment by crusher plants then can do a bungalow scheme etc_ _only genuine investor or buyer_ _if you have any suitable investor then let we know on priority_ _loi with offer is mandatory for visit and meeting_ _owner is moving to another country so want to close this deal as earliest_

ro hausa becana hai lotasa parka size 1550 sektara a 950 skeyara phita bana hai parsanala boringa 60 lakha

omaxe city 1 ab bypass road indore • shubhangan • 3 bhk prime villa • plot size 807 size • dimension 2040 • construction area 1750 • individual boring • modular kitchen • pop in rooms and hall • car parking available • wallpaper in rooms are there • price 65 lac / booking start grab this opportunity to get the best offers • call for more details

shift into your new 2 bhk flat just at price 36 lakh centre of indore on re 2 road visit today last few ready possession units call 7049029990 laabham residency behind agrwal public school note please call only 7049029990

super corridor mr 5 par tirumala padmavati me garden faceing plot 1100 skvera phita ka rijanebal price me becana hai

dayarekta dila phayade ka sauda gardana phesinga indaura ujjaina roda ️ haive drima siti ke a sektara mem koloni ki mena roda para kamarsiyala plota becana hai size 1543 equal 645 size ft price 3300 price price size ft call 9826371151

dayarekta dila indaura ujjaina roda haive drima siti ke c 1 sektara mem salanga eka hi satha cara plota hai singala plota bhi de sakate hai size 2050 equal 1000 size ft price 2250 price price size ft call 9755103722 mp 09 propertys

project name shree kedar dham add ujjan road paliya square se 4 km andar plot size 430 s/f 1236 ews 525 s/f 1535 600 s/f 1540 800 s/f 2040 price 2450 s/f 430 ews 2650 s/f other plots included maintainence electricity registry charges extra

om namah sivaya mahakala proparti brokarsa 7898989638 7898689724 9826131131 [ 19 / 08 / 23 sanivara 1 mahalaksmi nagara mr 6 mem phayade ka plota becana hai plota size 2050 equal 1000 size pascima mukhi plota hai price dimanda rs 6900 / price size 2 mahalaksmi nagara mr 6 mem kornara digambara jaina mandira phesinga plota becana hai plota size 2050 equal 1000 size purva/uttara mukhi kornara plota digambara jaina mandira ke bilakula samane price dimanda rs 10000 / price size 3 mahalaksmi nagara saiktara r mem gardana phensinga bangalo becana hai plota size 2050 equal 1000 size gardana phensinga bangalo hai 4 bhk planinga dimanda rs 175 karora rupae manga hai 4 mahalaksmi nagara saiktara r mem 60 phita cauri roda ka kornara komarsiyala plota becana hai plota size 3250 equal 1600 size kornara plota pascima/daksina mukhi 60 phita cauri roda ka plota price dimanda rs 15000 / price size 5 mahalaksmi nagara mem 100 phita cauri roda ka phula komarsiyala plota becana hai plota size 7070 equal 4900 size daksina mukhi plota hai price dimanda rs 17000 / price size 6 hare krsna vihara koloni nipaniya mem gardana phensinga plota becana hai plota size 3050 equal 1500 size pascima gardana phensinga plota price dimanda rs 8500 / rupae size 7 vrndavana dhama koloni nipaniya mem gardana phesinga plota becana hai plota size 45100 equal 4500 size pascima mukhi gardana phensinga plota hai price dimanda rs 4000 / price size 8 mahalaksmi nagara mr 1 mem sanadara kornara plota para bana dupleksa becana hai plota size 2050 equal 1000 size purva/daksina mukhi kornara dupleksa vitha terrace gazebo 2700 size kanstraksana 4 bhk planinga dimanda rs 175 karora rupae manga hai 9 srinatha koloni nipaniya mem sanadara bangalo becana hai plota size 3050 equal 1500 size purva mukhi gardana phensinga bangalo 3250 size kanstraksana evam 4 bhk planinga hai dimanda rs 185 karora rupae manga hai 10 tulasi nagara a sektara mem primiyama gurudvara ke pasa vala plota becana he plota size 3050 equal 1500 size uttara mukhi plota gurudvara ke pasa ki primiyama lokesana he price dimanda rs 6300 / rupae size manga he fasta pementa kandisana para aura gunjaisa ki ja sakati he 11 tulasi nagara koloni ke b sektara mem kornara jori plata becana haim plota size 3050 equal 15001500 sqft ki kornara jori plota he disa uttara/pascima phesinga 2 saida opana roda evam price dimanda rs 7050 / rupae size manga hai kevala kornara plota cahie to mila jayega